SNAPC5 Antibody - N-terminal region : HRP

SNAPC5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57932_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: snRNA-activating protein complex subunit 5

Protein Size: 98

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP57932_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57932_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10302
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×