SND1-IT1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNIT1

Key Reference: N/A

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: LRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 110

Purification: Affinity purified

• Artikelnummer: AVIARP55045_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55045_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27099
• Wirt: Rabbit