Snx10 Antibody - middle region : FITC

Snx10 Antibody - middle region : FITC
Artikelnummer
AVIARP54936_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles.

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-10

Protein Size: 201

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54936_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54936_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 71982
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×