SNX11 Antibody - middle region : FITC

SNX11 Antibody - middle region : FITC
Artikelnummer
AVIARP55482_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein.

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: GTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-11

Protein Size: 270

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55482_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55482_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29916
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×