SPATA2 Antibody - C-terminal region : FITC

SPATA2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP59150_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPATA2 may have a role in the regulation of spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 2

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59150_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59150_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9825
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×