SPATA7 Antibody - middle region : HRP

SPATA7 Antibody - middle region : HRP
Artikelnummer
AVIARP57243_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of the SPATA7 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPATA7

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis-associated protein 7

Protein Size: 599

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57243_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57243_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55812
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×