SPDYA Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPDYA

Key Reference: McAndrew,C.W., (2007) Cell Cycle 6 (15), 1937-1945

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Speedy protein A

Protein Size: 313

Purification: Affinity Purified

• Artikelnummer: AVIARP55845_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55845_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 245711
• Wirt: Rabbit