SPDYE1 Antibody - C-terminal region : FITC

SPDYE1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57845_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: RCMNPRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein E1

Protein Size: 336

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57845_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57845_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285955
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×