SPINK6 Antibody - middle region : Biotin

SPINK6 Antibody - middle region : Biotin
Artikelnummer
AVIARP55978_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINK6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine protease inhibitor Kazal-type 6

Protein Size: 80

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55978_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55978_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 404203
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×