SSBP3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSBP3

Key Reference: Adams,M.D., (2006) Biochem. Biophys. Res. Commun. 339 (3), 977-984

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Single-stranded DNA-binding protein 3

Protein Size: 368

Purification: Affinity Purified

• Artikelnummer: AVIARP55355_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55355_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23648
• Wirt: Rabbit