SSX1 Antibody - middle region : Biotin

SSX1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57900_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSX1

Key Reference: Tornkvist,M., (2008) Biochem. Biophys. Res. Commun. 368 (3), 793-800

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SSX1

Protein Size: 188

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57900_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57900_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6756
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×