STIMATE Antibody - N-terminal region : HRP

STIMATE Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55905_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM110

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: store-operated calcium entry regulator STIMATE

Protein Size: 294

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55905_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55905_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 375346
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×