STK32B Antibody - middle region : FITC

STK32B Antibody - middle region : FITC
Artikelnummer
AVIARP57238_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human STK32B

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 32B

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57238_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57238_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55351
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×