SUN3 Antibody - C-terminal region : FITC

SUN3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54471_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SUN3

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SUN domain-containing protein 3

Protein Size: 269

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54471_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54471_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256979
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×