SUNC1 Antibody - C-terminal region : HRP

SUNC1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54470_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUNC1

Key Reference: Osada,N., (er) BMC Genomics 3 (1), 36 (2002)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SUN domain-containing protein 3

Protein Size: 357

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54470_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54470_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256979
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×