English
SUR2A Antibody, Clone N319A/14: HRP
Mouse Anti-Mouse SUR2A Monoclonal IgG2A
Artikelnummer
STRSMC-431D-HRP
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Target: SUR2A
Conjugate: HRP
Product Type: Monoclonal
Clone Number: N319A/14 (Formerly sold as S319A-14)
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Swiss-Prot: P70170
Purification: Protein G Purified
Storage Buffer: PBS pH7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Concentration: 1 mg/ml
Specificity: Detects ~120kDa. Does not cross-react with SUR2B.
Cellular Localization: Membrane
Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References: 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Conjugate: HRP
Product Type: Monoclonal
Clone Number: N319A/14 (Formerly sold as S319A-14)
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Swiss-Prot: P70170
Purification: Protein G Purified
Storage Buffer: PBS pH7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Concentration: 1 mg/ml
Specificity: Detects ~120kDa. Does not cross-react with SUR2B.
Cellular Localization: Membrane
Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References: 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
| Artikelnummer | STRSMC-431D-HRP |
|---|---|
| Hersteller | Stressmarq Biosciences |
| Hersteller Artikelnummer | SMC-431D-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100 µg |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus) |
| Klonalität | Monoclonal |
| Methode | Immunofluorescence, Western Blotting, Immunohistochemistry, Immunocytochemistry |
| Isotyp | IgG2a |
| Human Gene ID | 20928 |
| Wirt | Mouse |
| Produktinformation (PDF) | Download |
| MSDS (PDF) | Download |
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
