TASP1 Antibody - middle region : Biotin

TASP1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57018_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits, which reassemble into the active alpha2-beta2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TASP1

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Threonine aspartase 1

Protein Size: 420

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57018_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57018_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55617
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×