Tau-352 (fetal 0N3R) Wild-Type Monomers

Human Recombinant Tau-352 (fetal 0N3R) Wild-Type Monomers
Artikelnummer
STRSPR-490B
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Tau-352 (fetal 0N3R)

Nature: Recombinant

Swiss-Prot: P10636-2

Biological Activity:

Expression System: E. coli

Protein Length: Full Length (1-352 aa)

Amino Acid Sequence: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: 10 mM Hepes pH 7.4, 100 mM NaCl

Protein Size: 37 kDa

Conjugate: No Tag

Cellular Localization: Axolemma,Axolemma Plasma Membrane,Axon,Cell Body,Cell membrane,Cytoplasm,Cytoplasmic Ribonucleoprotein Granule,Cytoplasmic Side,Cytoskeleton,Cytosol,Dendrite,Growth cone,Microtubule,Microtubule Associated Complex,Neurofibrillary Tangle,Neuronal Cell Body,Nuclear Periphery,Nuclear Speck,Nucleus,Peripheral membrane protein,Plasma Membrane,Tubulin complex

Scientific Background: Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing paired helical filaments (PHFs). Brain-specific tau isoforms vary in the number of N-terminal inserts and C- terminal repeat domains due to alternative splicing of exons; only the shortest isoform of tau, 0N3R, is expressed in the fetal brain during neurogenesis (2). Three-repeat (3R) isoforms have been shown to be more prone than four-repeat (4R) isoforms to form oligomers in vitro (3). The β-sheet core of Tau 0N3R fibrilized using heparin differs from all other tau fibril structures known to date (4).

References: 1. www.alz.org/alzheimers-dementia/facts-figures2. Goedert et al. Multiple isoforms of human microtubule-associated protein tau: Sequences and localization in neurofibrilary tangles of Alzheimer’s disease. Neuron. 1989;3(4):519-526.3. Shahpasand-Kroner et al. Three-repeat and four-repeat tau isoforms for different oligomers. Prot. Sci. 2021;doi: 10.1002/pro42574. Dregni, et al. Inclusion of the C‑Terminal Domain in the β‑Sheet Core of Heparin-Fibrillized Three-Repeat Tau Protein Revealed by Solid-State Nuclear Magnetic Resonance Spectroscopy. JACS. 2021. https://doi.org/10.1021/jacs.1c03314

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-490B
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-490B
Green Labware Nein
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human
Methode Western Blotting, SDS-PAGE
Human Gene ID 4137
Produktinformation (PDF) Download
MSDS (PDF) Download