English
TBC1D10C Antibody - N-terminal region : HRP
TBC1D10C Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55894_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D10C
Key Reference: Pan,F., (2007) Nature 445 (7126), 433-436
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Carabin
Protein Size: 446
Purification: Affinity Purified
Description of Target: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D10C
Key Reference: Pan,F., (2007) Nature 445 (7126), 433-436
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Carabin
Protein Size: 446
Purification: Affinity Purified
| Artikelnummer | AVIARP55894_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55894_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 374403 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
