English
TBC1D14 Antibody - N-terminal region : Biotin
TBC1D14 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56315_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14
Key Reference: Tempel,W., (2008) Proteins 71 (1), 497-502
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: TBC1 domain family member 14
Protein Size: 693
Purification: Affinity Purified
Description of Target: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14
Key Reference: Tempel,W., (2008) Proteins 71 (1), 497-502
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: TBC1 domain family member 14
Protein Size: 693
Purification: Affinity Purified
| Artikelnummer | AVIARP56315_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56315_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 57533 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
