TBC1D25 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN TBC1D25

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: STFEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified

• Artikelnummer: AVIARP56370_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56370_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4943
• Wirt: Rabbit