TBC1D25 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D25

Key Reference: Aizawa,T., (2003) Biochim. Biophys. Acta 1603 (2), 47-82

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified

• Artikelnummer: AVIARP56369_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56369_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4943
• Wirt: Rabbit