Tbc1d7 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Tbc1d7 is a component of the TSC-TBC complex, that contains TBC1D7 in addition to the TSC1-TSC2 complex and consists of the functional complex possessing GTPase-activating protein (GAP) activity toward RHEB in response to alterations in specific cellular growth conditions. The small GTPase RHEB is a direct activator of the protein kinase activity of mTORC1 and the TSC-TBC complex acts as a negative regulator of mTORC1 signaling cascade by acting as a GAP for RHEB. Participates in the proper sensing of growth factors and glucose, but not amino acids, by mTORC1. It is unclear whether TBC1D7 acts as a GTPase-activating protein and additional studies are required to answer this question.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tbc1d7

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 7

Protein Size: 293

Purification: Affinity Purified

• Artikelnummer: AVIARP56927_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56927_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 67046
• Wirt: Rabbit