Tbx10 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tbx10 is a probable transcriptional regulator involved in developmental processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FVDPRKDSARYAQENFKSFVFTETQFTAVTAYQNHRITQLKIASNPFAKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-box transcription factor TBX10

Protein Size: 385

Purification: Affinity Purified

• Artikelnummer: AVIARP58030_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58030_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 109575
• Wirt: Rabbit