TBX2 Antibody - N-terminal region : Biotin

TBX2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57903_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX2 is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX2

Key Reference: Abrahams,A., (2008) J. Biol. Chem. 283 (4), 2223-2230

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: EAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-box transcription factor TBX2

Protein Size: 702

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57903_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57903_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6909
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×