TCP11L1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TCP11L1

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 1

Protein Size: 595

Purification: Affinity Purified

• Artikelnummer: AVIARP57234_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57234_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55346
• Wirt: Rabbit