TCP11L1 Antibody - C-terminal region : FITC

TCP11L1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57234_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TCP11L1

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 1

Protein Size: 595

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57234_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57234_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55346
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×