Tdrd7 Antibody - C-terminal region : Biotin

Tdrd7 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55002_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tudor domain-containing protein 7

Protein Size: 1113

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55002_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55002_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 85425
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×