English
Terf2ip Antibody - middle region : FITC
Terf2ip Antibody - middle region : FITC
Artikelnummer
AVIARP57301_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Telomeric repeat-binding factor 2-interacting protein 1
Protein Size: 286
Purification: Affinity Purified
Description of Target: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Telomeric repeat-binding factor 2-interacting protein 1
Protein Size: 286
Purification: Affinity Purified
| Artikelnummer | AVIARP57301_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57301_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 57321 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
