Tfam Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor A, mitochondrial

Protein Size: 243

Purification: Affinity Purified

• Artikelnummer: AVIARP58722_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58722_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 21780
• Wirt: Rabbit