TMEM146 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM146

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cation channel sperm-associated protein subunit delta

Protein Size: 798

Purification: Affinity Purified

• Artikelnummer: AVIARP55551_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55551_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 257062
• Wirt: Rabbit