English
TMEM166 antibody
TMEM166 antibody
Artikelnummer
GTX04091-100
Verpackungseinheit
100 μg
Hersteller
GeneTex
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Calculated MW: 17
Form: Liquid
Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)
Uniprot ID: Q9H8M9
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: eva-1 homolog A, regulator of programmed cell death
Form: Liquid
Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
Concentration: .5 mg/ml (Please refer to the vial label for the specific concentration.)
Uniprot ID: Q9H8M9
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: eva-1 homolog A, regulator of programmed cell death
| Artikelnummer | GTX04091-100 |
|---|---|
| Hersteller | GeneTex |
| Hersteller Artikelnummer | GTX04091-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 μg |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Flow Cytometry, Immunocytochemistry |
| Isotyp | IgG |
| Human Gene ID | 84141 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
