TMF1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMF1

Key Reference: Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TATA element modulatory factor

Protein Size: 1093

Purification: Affinity Purified

• Artikelnummer: AVIARP58092_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58092_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7110
• Wirt: Rabbit