TMOD3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMOD3

Key Reference: Weber,K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tropomodulin-3

Protein Size: 352

Purification: Affinity Purified

• Artikelnummer: AVIARP55078_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55078_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29766
• Wirt: Rabbit