TMPRSS12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMPRSS12

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane protease serine 12

Protein Size: 348

Purification: Affinity Purified

• Artikelnummer: AVIARP55819_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55819_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283471
• Wirt: Rabbit