TNPO2 Antibody - C-terminal region : HRP

TNPO2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54956_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TNPO2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transportin-2

Protein Size: 887

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54956_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54956_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30000
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×