TOB2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TOB2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Tob2

Protein Size: 344

Purification: Affinity Purified

• Artikelnummer: AVIARP58112_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58112_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10766
• Wirt: Rabbit