TP53INP2 Antibody - C-terminal region : Biotin

TP53INP2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58965_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of TP53INP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein p53-inducible nuclear protein 2

Protein Size: 220

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58965_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58965_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 58476
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×