Traf3ip1 Antibody - N-terminal region : Biotin

Traf3ip1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55316_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Traf3ip1 play an inhibitory role on IL13 signaling by binding to IL13RA1. It is involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. It recruits TRAF3 and DISC1 to the microtubules.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TRAF3-interacting protein 1

Protein Size: 625

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55316_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55316_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 74019
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×