TRAPPC1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC1

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 1

Protein Size: 145

Purification: Affinity Purified

Subunit: 1

• Artikelnummer: AVIARP57531_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57531_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 58485
• Wirt: Rabbit