TRIB2 Antibody - middle region : HRP

TRIB2 Antibody - middle region : HRP
Artikelnummer
AVIARP55377_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB2

Key Reference: Lin,K.R., (2007) J. Biol. Chem. 282 (30), 21962-21972

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tribbles homolog 2

Protein Size: 343

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55377_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55377_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28951
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×