TRIB3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tribbles homolog 3

Protein Size: 358

Purification: Affinity Purified

• Artikelnummer: AVIARP57518_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57518_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57761
• Wirt: Rabbit