TRIB3 Antibody - N-terminal region : HRP

TRIB3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57518_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tribbles homolog 3

Protein Size: 358

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57518_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57518_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57761
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×