English
TRIM10 Antibody - C-terminal region : Biotin
TRIM10 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57848_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10
Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tripartite motif-containing protein 10
Protein Size: 481
Purification: Affinity Purified
Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10
Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tripartite motif-containing protein 10
Protein Size: 481
Purification: Affinity Purified
| Artikelnummer | AVIARP57848_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57848_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10107 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
