TRIM10 Antibody - C-terminal region : FITC

TRIM10 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57848_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10

Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 10

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57848_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57848_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10107
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×