TRIM25 Antibody - middle region : FITC

TRIM25 Antibody - middle region : FITC
Artikelnummer
AVIARP58105_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presence of potential DNA-binding and dimerization-transactivation domains suggests that this protein may act as a transcription factor, similar to several other members of the TRIM family. Expression of the gene is upregulated in response to estrogen, and it is thought to mediate estrogen actions in breast cancer as a primary response gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM25

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin/ISG15 ligase TRIM25

Protein Size: 630

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58105_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58105_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7706
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×