TRIM31 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Key Reference: Collins,J.E., Genome Biol. 5 (10), R84 (2004)

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase TRIM31

Protein Size: 425

Purification: Affinity Purified

• Artikelnummer: AVIARP57947_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57947_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11074
• Wirt: Rabbit