English
TRIM38 Antibody - middle region : FITC
TRIM38 Antibody - middle region : FITC
Artikelnummer
AVIARP57852_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM38
Molecular Weight: 53kDa
Peptide Sequence: Synthetic peptide located within the following region: LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tripartite motif-containing protein 38
Protein Size: 465
Purification: Affinity Purified
Description of Target: TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM38
Molecular Weight: 53kDa
Peptide Sequence: Synthetic peptide located within the following region: LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tripartite motif-containing protein 38
Protein Size: 465
Purification: Affinity Purified
| Artikelnummer | AVIARP57852_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57852_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10475 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
