TRIM58 Antibody - middle region : Biotin

TRIM58 Antibody - middle region : Biotin
Artikelnummer
AVIARP57993_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM58

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 58

Protein Size: 486

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57993_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57993_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25893
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×