TRMT13 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRM13

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA:m(4)X modification enzyme TRM13 homolog

Protein Size: 481

Purification: Affinity purified

• Artikelnummer: AVIARP57328_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57328_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54482
• Wirt: Rabbit